PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009764837.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 745aa    MW: 84381.4 Da    PI: 5.7291
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009764837.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS370.91.7e-1133727422373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++lL++cA+ v+++d + a++ L+++++++sp+gd+ qRla++f+ +L+arla+++++ y+al+p++ +    +e+l+a++++   +P+ k+s +
  XP_009764837.1 372 RTLLISCAQSVAADDRRTANEQLKHIRQHSSPTGDAYQRLASVFADGLEARLAGTGTQQYAALAPKRIT---AAEKLKAYQVYLSSCPFKKISIF 463
                     789*************************************************************99999...9********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      aN++I   +++++++H iDf+i++G+QWp L+q L++ p+gpp+lRiTg++ p++g   +e+le+tg+rLak++e+++vpfe+n+++++++e++
  XP_009764837.1 464 FANKMIFHTASNARTLHLIDFGITYGFQWPILIQLLSQIPGGPPKLRITGIDLPQPGfrPAESLEQTGSRLAKYCERFHVPFEYNAIATQNWENI 558
                     ********************************************************9******************************999***** PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     ++e+L++ +gE++aVn+ ++l++llde+v ++s+rd+vL+l+++++P+++v +  + +++++ F++rf eal +ys+lfd+++a+lpr++++r  
  XP_009764837.1 559 KIEDLKLASGETVAVNCLFRLKNLLDETVVVDSPRDAVLSLIRKMNPDIFVQAVVNGSYSAPFFVTRFREALFHYSTLFDMFDATLPRDDQQRLH 653
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      E+e+ +re++nv+aceg+er+er et+++W+ r ++aGFk +pl+++ +++ ++ ++  + + +  +e+ +++++gWk+r + + S+W
  XP_009764837.1 654 FEQEFYRREAMNVIACEGSERVERPETYKQWQVRYMRAGFKLLPLNQQLMQKLRCKVKGGYHRDFVFDEDGNWMLQGWKGRVVCASSCW 742
                     *************************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.214345723IPR005202Transcription factor GRAS
PfamPF035145.9E-111372742IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MDPRFNPLPH PVNTFEFEDQ INLSSFEESL NHPLSYTDNY VAFGAPYNTS SPDVGNFAPS  60
SNVSSEVDSP DDHDSDSLFK YLNQILMEEN IEDKPSMFHD PLALKAAEKS FYEALGKSYP  120
PSPYRTSDYV YHQLKSPDSI FWNSSEHSTS SSNTGTNSTD PQWVVDPGEF RLPVEGHPSE  180
YNVQPLVQSN SERSRGSLNN FNNSNAHVDT LVNPNVFTDS ESILQFRRGM EEASKFLPNL  240
SQFVIDLDKY TLPPKMEEVS KEAVVKVEKD EKNHSPNGTK GRKHQYPEDS DHEDERSNKQ  300
SAIYVEEEVE LSEMFDRVLL CTDKGTGCGD VKREMPSEVN MSSDQNGQAH GSNGGKTRAK  360
KQATKNEAVD IRTLLISCAQ SVAADDRRTA NEQLKHIRQH SSPTGDAYQR LASVFADGLE  420
ARLAGTGTQQ YAALAPKRIT AAEKLKAYQV YLSSCPFKKI SIFFANKMIF HTASNARTLH  480
LIDFGITYGF QWPILIQLLS QIPGGPPKLR ITGIDLPQPG FRPAESLEQT GSRLAKYCER  540
FHVPFEYNAI ATQNWENIKI EDLKLASGET VAVNCLFRLK NLLDETVVVD SPRDAVLSLI  600
RKMNPDIFVQ AVVNGSYSAP FFVTRFREAL FHYSTLFDMF DATLPRDDQQ RLHFEQEFYR  660
REAMNVIACE GSERVERPET YKQWQVRYMR AGFKLLPLNQ QLMQKLRCKV KGGYHRDFVF  720
DEDGNWMLQG WKGRVVCASS CWVPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-413756998329GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009764837.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLK4C9Y80.0K4C9Y8_SOLLC; Uncharacterized protein
STRINGSolyc06g076280.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14